Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAAF1 Rabbit Polyclonal Antibody (HRP)

DNAAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DAAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGSSDTSYHSQQKQSGDNGSGGHFAHPREDREDRGPRMTKSSLQKLCKQH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRB1 siRNA (Mouse)
MBS8207095-01 15 nmol

CTRB1 siRNA (Mouse)

Sign In for Pricing
View Details
CTRB1 siRNA (Mouse)
MBS8207095-02 30 nmol

CTRB1 siRNA (Mouse)

Sign In for Pricing
View Details
CTRB1 siRNA (Mouse)
MBS8207095-03 5x 30 nmol

CTRB1 siRNA (Mouse)

Sign In for Pricing
View Details
LULL1/TOR1AIP2 Rabbit Polyclonal Antibody (Cy7)
orb1069772 100 µL

LULL1/TOR1AIP2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Triosephosphate Isomerase (Triose-phosphate Isomerase, TIM, TPI, Triosephosphate Isomerase 1, Triose-phosphate Isomerase 1, TPI 1, TPI1, MGC88108) (MaxLight 750) discontinued
134775-ML750 100 µL

Triosephosphate Isomerase (Triose-phosphate Isomerase, TIM, TPI, Triosephosphate Isomerase 1, Triose-phosphate Isomerase 1, TPI 1, TPI1, MGC88108) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human GM130/GOLGA2 Recombinant Protein
PPT-12925 100 µg

Human GM130/GOLGA2 Recombinant Protein

Sign In for Pricing
View Details