Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAAF1 Rabbit Polyclonal Antibody (FITC)

DNAAF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DAAF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYA

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-YES1-Specific antibody
PAab09563 100 µg

Anti-YES1-Specific antibody

Sign In for Pricing
View Details
KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)
MBS6312780-01 0.1 mL

KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)

Sign In for Pricing
View Details
KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)
MBS6312780-02 5x 0.1 mL

KCNV1, NT (KCNV1, Potassium voltage-gated channel subfamily V member 1, Neuronal potassium channel alpha subunit HNKA, Voltage-gated potassium channel subunit Kv8.1) (MaxLight 405)

Sign In for Pricing
View Details
ADAMDEC1 Polyclonal Antibody
RA21658-01 50 µL

ADAMDEC1 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMDEC1 Polyclonal Antibody
RA21658-02 100 µL

ADAMDEC1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike Protein Receptor Binding Domain [mFc]
DAGC174 1 mg

Recombinant SARS-CoV-2 Spike Protein Receptor Binding Domain [mFc]

Sign In for Pricing
View Details