Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5A Rabbit Polyclonal Antibody (FITC)

KMT5A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SET8, SET07, SETD8, PR-Set7, PR/SET07

UniProt

Q9NQR1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SETD8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPI

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPRT1 Polyclonal Antibody FITC Conjugated
orb1540625 100 µL

NAPRT1 Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
5-[ (2-Fluorophenyl) methoxy]-1,3-dimethyl-1H-pyrazole-4-carboxylic acid
SIC88448-01 50 mg

5-[ (2-Fluorophenyl) methoxy]-1,3-dimethyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
5-[ (2-Fluorophenyl) methoxy]-1,3-dimethyl-1H-pyrazole-4-carboxylic acid
SIC88448-02 0.5 g

5-[ (2-Fluorophenyl) methoxy]-1,3-dimethyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
HNMT, Recombinant, Human, aa1-292, His-Tag (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2, MRT51)
396878-01 5 µg

HNMT, Recombinant, Human, aa1-292, His-Tag (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2, MRT51)

Sign In for Pricing
View Details
HNMT, Recombinant, Human, aa1-292, His-Tag (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2, MRT51)
396878-02 20 µg

HNMT, Recombinant, Human, aa1-292, His-Tag (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2, MRT51)

Sign In for Pricing
View Details
KRT4, Recombinant, Human, aa1-534, His-SUMO-Tag (Keratin, Type II Cytoskeletal 4)
373960-01 20 µg

KRT4, Recombinant, Human, aa1-534, His-SUMO-Tag (Keratin, Type II Cytoskeletal 4)

Sign In for Pricing
View Details