Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5A Rabbit Polyclonal Antibody (HRP)

KMT5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SET8, SET07, SETD8, PR-Set7, PR/SET07

UniProt

Q9NQR1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SETD8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPI

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Integrin Alpha 2 (ITGa2) ELISA Kit
DLR-ITGa2-Ra-48T 48 Tests

Rat Integrin Alpha 2 (ITGa2) ELISA Kit

Sign In for Pricing
View Details
Rxfp3 3'UTR Lenti-reporter-Luc Vector
42912086 1.0 µg

Rxfp3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ERK1/2 Monoclonal Antibody, PerCP Conjugated
bsm-33232M-PerCP 100 µL

ERK1/2 Monoclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Junctophilin 2 (JPH2) (NM_020433) Human Mass Spec Standard
PH319661 10 µg

Junctophilin 2 (JPH2) (NM_020433) Human Mass Spec Standard

Sign In for Pricing
View Details
GPx-4 CRISPR Activation Plasmid (h2)
sc-401558-ACT-2 20 µg

GPx-4 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
GENLISA Rat SERPINA6 (Corticosteroid-binding globulin) ELISA
KLR6539 1x 96 Well

GENLISA Rat SERPINA6 (Corticosteroid-binding globulin) ELISA

Sign In for Pricing
View Details