Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNC1 Rabbit Polyclonal Antibody (HRP)

BNC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BNC, BSN1, POF16, HsT19447

UniProt

Q01954

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human BNC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFPNL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

109kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5A1 (ATP Synthase Subunit Alpha, Mitochondrial, ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Alpha Subunit 1, Cardiac Muscle)
475914 100 µL

ATP5A1 (ATP Synthase Subunit Alpha, Mitochondrial, ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, Alpha Subunit 1, Cardiac Muscle)

Sign In for Pricing
View Details
Cga 3'UTR Luciferase Stable Cell Line
TU103789 1.0 mL

Cga 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
1- (methylsulfanyl) butan-1-one
T203874 100 mg

1- (methylsulfanyl) butan-1-one

Sign In for Pricing
View Details
Oas1h ORF Vector (Rat) (pORF)
ORF071655 1.0 µg DNA

Oas1h ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LentimiRa-hsa-mir-4291 Vector
mh40671 500 ng

LentimiRa-hsa-mir-4291 Vector

Sign In for Pricing
View Details
Monoclonal Antibody to Actin Alpha 1, Cardiac Muscle (ACTC1)
TRV-0035849-01 20 µL

Monoclonal Antibody to Actin Alpha 1, Cardiac Muscle (ACTC1)

Sign In for Pricing
View Details