Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1E Rabbit Polyclonal Antibody (FITC)

CD1E Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

R2, CD1A

UniProt

P15812

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CD1E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLY

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (AP)
MBS6387733-01 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (AP)

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (AP)
MBS6387733-02 5x 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (AP)

Sign In for Pricing
View Details
Aquaporin 4 Rabbit Polyclonal Antibody (Biotin)
orb460817 100 µL

Aquaporin 4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SF4, ID (SUGP1, SF4, SURP and G-patch domain-containing protein 1, RNA-binding protein RBP, Splicing factor 4) (MaxLight 550) discontinued
041618-ML550 100 µL

SF4, ID (SUGP1, SF4, SURP and G-patch domain-containing protein 1, RNA-binding protein RBP, Splicing factor 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Ndor1 shRNA (UAS) - Lentiviral mouse Ndor1 shRNA (UAS, iRFP) plasmid
GTR15267232 1 Vial

Lentiviral mouse Ndor1 shRNA (UAS) - Lentiviral mouse Ndor1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ZSCAN5B, CT (ZSCAN5B, Zinc finger and SCAN domain-containing protein 5B) (FITC)
MBS6368244-01 0.2 mL

ZSCAN5B, CT (ZSCAN5B, Zinc finger and SCAN domain-containing protein 5B) (FITC)

Sign In for Pricing
View Details