Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1E Rabbit Polyclonal Antibody (HRP)

CD1E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R2, CD1A

UniProt

P15812

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CD1E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLY

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D2A Antibody (Center) Blocking peptide
MBS9225619-01 0.5 mg

SH2D2A Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
SH2D2A Antibody (Center) Blocking peptide
MBS9225619-02 5x 0.5 mg

SH2D2A Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
VE Assay Kit (Visible Spectrophotometry)
CB0143V 50 Tests

VE Assay Kit (Visible Spectrophotometry)

Sign In for Pricing
View Details
Human GTP-binding protein 1, GTPBP1 ELISA Kit
MBS1606281-01 48 Well

Human GTP-binding protein 1, GTPBP1 ELISA Kit

Sign In for Pricing
View Details
Human GTP-binding protein 1, GTPBP1 ELISA Kit
MBS1606281-02 96 Well

Human GTP-binding protein 1, GTPBP1 ELISA Kit

Sign In for Pricing
View Details
Human GTP-binding protein 1, GTPBP1 ELISA Kit
MBS1606281-03 5x 96 Well

Human GTP-binding protein 1, GTPBP1 ELISA Kit

Sign In for Pricing
View Details