Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1A1 Rabbit Polyclonal Antibody (HRP)

CSNK1A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CK1, CK1a, CKIa, HLCDGP1, PRO2975, HEL-S-77p

UniProt

P48729

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KC1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Human Disease, Multiple Sclerosis, Brain, Temporal Lobe
MBS657085-01 1 mg

Tissue, Total Protein, Human Disease, Multiple Sclerosis, Brain, Temporal Lobe

Sign In for Pricing
View Details
Tissue, Total Protein, Human Disease, Multiple Sclerosis, Brain, Temporal Lobe
MBS657085-02 5x 1 mg

Tissue, Total Protein, Human Disease, Multiple Sclerosis, Brain, Temporal Lobe

Sign In for Pricing
View Details
ARHGEF10 (Rho Guanine Nucleotide Exchange Factor (GEF) 10, DKFZp686H0726, GEF10, MGC131664) (MaxLight 405) discontinued
243461-ML405 100 µL

ARHGEF10 (Rho Guanine Nucleotide Exchange Factor (GEF) 10, DKFZp686H0726, GEF10, MGC131664) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LTP11 Antibody
orb792828 2 mg

LTP11 Antibody

Sign In for Pricing
View Details
Zfp523 siRNA Oligos set (Mouse)
51012174 3x 5 nmol

Zfp523 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
NadE Antibody
orb822747 2 mg

NadE Antibody

Sign In for Pricing
View Details