Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1D Rabbit Polyclonal Antibody (HRP)

CSNK1D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASPS, CKId, HCKID, FASPS2, CKIdelta, CKI-delta

UniProt

P48730

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KC1D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGT

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Sheep alpha-1-acid glycoprotein (AGP) ELISA Kit
GR116243 96 Well

Nori® Sheep alpha-1-acid glycoprotein (AGP) ELISA Kit

Sign In for Pricing
View Details
Rat CYP1B1 (Cytochrome P450 1B1) ELISA Kit
EK246861 96 Well

Rat CYP1B1 (Cytochrome P450 1B1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Dnajc5g shRNA (UAS) - Lentiviral mouse Dnajc5g shRNA (UAS) plasmid
GTR15195331 1 Vial

Lentiviral mouse Dnajc5g shRNA (UAS) - Lentiviral mouse Dnajc5g shRNA (UAS) plasmid

Sign In for Pricing
View Details
Boc-Ile-OH • 1/2 H2O
BLI-2065-01 5 g

Boc-Ile-OH • 1/2 H2O

Sign In for Pricing
View Details
Boc-Ile-OH • 1/2 H2O
BLI-2065-02 25 g

Boc-Ile-OH • 1/2 H2O

Sign In for Pricing
View Details
Boc-Ile-OH • 1/2 H2O
BLI-2065-03 100 g

Boc-Ile-OH • 1/2 H2O

Sign In for Pricing
View Details