Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Rabbit Polyclonal Antibody (HRP)

DDX10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dbp4, HRH-J8

UniProt

Q13206

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DDX10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EANKRQAKAKDEEEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSE

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_004389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-20RB Protein (C-Fc, Human)
P516138 100 µg

IL-20RB Protein (C-Fc, Human)

Sign In for Pricing
View Details
Campylobacter jejuni (APC) discontinued
C1037-13A-APC 100 µL

Campylobacter jejuni (APC) discontinued

Sign In for Pricing
View Details
CPT1A Rabbit pAb, BF680 conjugated
orb2460268 100 µL

CPT1A Rabbit pAb, BF680 conjugated

Sign In for Pricing
View Details
HE4/WFDC2 Rabbit Polyclonal Antibody (PE)
orb2611368 100 µg

HE4/WFDC2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ITPA, NT (ITPA, C20orf37, Inosine triphosphate pyrophosphatase, Non-canonical purine NTP pyrophosphatase, Non-standard purine NTP pyrophosphatase, Nucleoside-triphosphate diphosphatase, Nucleoside-triphosphate pyrophosphatase, Putative oncogene protein hlc14-06-p) (Biotin) discontinued
037162-Biotin 200 µL

ITPA, NT (ITPA, C20orf37, Inosine triphosphate pyrophosphatase, Non-canonical purine NTP pyrophosphatase, Non-standard purine NTP pyrophosphatase, Nucleoside-triphosphate diphosphatase, Nucleoside-triphosphate pyrophosphatase, Putative oncogene protein hlc14-06-p) (Biotin) discontinued

Sign In for Pricing
View Details
Canine Adenosine deaminase domain-containing protein 2 (ADAD2) ELISA Kit
MBS7232760-01 48 Well

Canine Adenosine deaminase domain-containing protein 2 (ADAD2) ELISA Kit

Sign In for Pricing
View Details