Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA3 Rabbit Polyclonal Antibody (FITC)

EFNA3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EFL2, EPLG3, LERK3, Ehk1-L

UniProt

P52797

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EFNA3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_004943

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Stromal Cell-Derived Factor-1 beta Recombinant
90239-A 2 µg

Mouse Stromal Cell-Derived Factor-1 beta Recombinant

Sign In for Pricing
View Details
COL8A1, NT (COL8A1, C3orf7, Collagen alpha-1(VIII) chain, Endothelial collagen, Vastatin) (MaxLight 550)
MBS6287753-01 0.1 mL

COL8A1, NT (COL8A1, C3orf7, Collagen alpha-1(VIII) chain, Endothelial collagen, Vastatin) (MaxLight 550)

Sign In for Pricing
View Details
COL8A1, NT (COL8A1, C3orf7, Collagen alpha-1(VIII) chain, Endothelial collagen, Vastatin) (MaxLight 550)
MBS6287753-02 5x 0.1 mL

COL8A1, NT (COL8A1, C3orf7, Collagen alpha-1(VIII) chain, Endothelial collagen, Vastatin) (MaxLight 550)

Sign In for Pricing
View Details
Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit
MBS9393494-01 48 Well

Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit

Sign In for Pricing
View Details
Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit
MBS9393494-02 96 Well

Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit

Sign In for Pricing
View Details
Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit
MBS9393494-03 5x 96 Well

Sheep WW Domain-Containing Transcription Regulator Protein 1 (WWTR1) ELISA Kit

Sign In for Pricing
View Details