Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA7 Rabbit Polyclonal Antibody (Biotin)

EPHA7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EHK3, EK11, EHK-3, HEK11

UniProt

Q15375

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYV

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ear5 Double Nickase Plasmid (m)
sc-424804-NIC 20 µg

Ear5 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Monoclonal Anti- SCD1 antibody
BRM1126-1 50 μL

Recombinant Monoclonal Anti- SCD1 antibody

Sign In for Pricing
View Details
CYP4A11/CYP4A22 Antibody
A12963-100UG 100 µg

CYP4A11/CYP4A22 Antibody

Sign In for Pricing
View Details
AMG 579 100mg
A21478-100 100 mg

AMG 579 100mg

Sign In for Pricing
View Details
Lentiviral human RSU1 sgRNA gene knockout kit - Lentiviral human RSU1 sgRNA gene knockout kit (25)
GTR15397644 1 Vial

Lentiviral human RSU1 sgRNA gene knockout kit - Lentiviral human RSU1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass
MBS6265487-01 0.1 mL

MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass

Sign In for Pricing
View Details