Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCNT2 Rabbit Polyclonal Antibody (Biotin)

GCNT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

II, CCAT, IGNT, ULG3, GCNT5, GCNT2C, NACGT1, NAGCT1, CTRCT13, bA421M1.1, bA360O19.2

UniProt

Q8NFS9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNT2C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACN

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_663630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

18-chloro-2-phenyl-10,20-dioxapentacyclo[11.7.0.03,11.04,9.014,19]icosa-1 (13),2,4,6,8,11,14,16,18-nonaene
JH916686 1 Each

18-chloro-2-phenyl-10,20-dioxapentacyclo[11.7.0.03,11.04,9.014,19]icosa-1 (13),2,4,6,8,11,14,16,18-nonaene

Sign In for Pricing
View Details
Lentiviral mouse Suco shRNA (UAS) - Lentiviral mouse Suco shRNA (UAS, RFP) (25)
GTR15200807 1 Vial

Lentiviral mouse Suco shRNA (UAS) - Lentiviral mouse Suco shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-669o-5p-Off Virus
mm5916 1.0 mL

AdmiRa-mmu-miR-669o-5p-Off Virus

Sign In for Pricing
View Details
ARL6IP5 Antibody Blocking Peptide
orb1500312 500 µg

ARL6IP5 Antibody Blocking Peptide

Sign In for Pricing
View Details
STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (HRP)
MBS6501258-01 0.2 mL

STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (HRP)

Sign In for Pricing
View Details
STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (HRP)
MBS6501258-02 5x 0.2 mL

STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (HRP)

Sign In for Pricing
View Details