Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Rabbit Polyclonal Antibody (Biotin)

GSTM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b

UniProt

P09488

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GSTM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYL

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK, phosphorylated (Ser78) (Serine/threonine-protein Kinase Sgk1, Serum/glucocorticoid Regulated Kinase 1, SGK1) (Not for Export EU)
S1010-84C 100 µL

SGK, phosphorylated (Ser78) (Serine/threonine-protein Kinase Sgk1, Serum/glucocorticoid Regulated Kinase 1, SGK1) (Not for Export EU)

Sign In for Pricing
View Details
Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb
MBS9146599-01 0.02 mL

Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb
MBS9146599-02 0.1 mL

Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb

Sign In for Pricing
View Details
Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb
MBS9146599-03 5x 0.1 mL

Phospho-Acetyl CoA Carboxylase-S79 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 Bifunctional protein FolD (folD)
MBS1142969-01 0.02 mg (E-Coli)

Recombinant Chlamydia trachomatis serovar L2 Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 Bifunctional protein FolD (folD)
MBS1142969-02 0.02 mg (Yeast)

Recombinant Chlamydia trachomatis serovar L2 Bifunctional protein FolD (folD)

Sign In for Pricing
View Details