Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT3 Rabbit Polyclonal Antibody (Biotin)

IFIT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG-49, GARG-49

UniProt

O14879

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLL

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001540.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deaf1, CT (Deformed Epidermal Autoregulatory Factor 1 Homolog, Nuclear DEAF-1-related Transcriptional Regulator, NUDR) (MaxLight 405)
MBS6472190-01 0.1 mL

Deaf1, CT (Deformed Epidermal Autoregulatory Factor 1 Homolog, Nuclear DEAF-1-related Transcriptional Regulator, NUDR) (MaxLight 405)

Sign In for Pricing
View Details
Deaf1, CT (Deformed Epidermal Autoregulatory Factor 1 Homolog, Nuclear DEAF-1-related Transcriptional Regulator, NUDR) (MaxLight 405)
MBS6472190-02 5x 0.1 mL

Deaf1, CT (Deformed Epidermal Autoregulatory Factor 1 Homolog, Nuclear DEAF-1-related Transcriptional Regulator, NUDR) (MaxLight 405)

Sign In for Pricing
View Details
WDYHV1 Protein Vector (Human) (pPM-C-His)
PV046360 500 ng

WDYHV1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human ZNF432 Pre-designed siRNA Set B
SI018811B 1 Each

Human ZNF432 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Human B3GNT6 Polyclonal Antibody
HC130014-01 50 µg

Anti-Human B3GNT6 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human B3GNT6 Polyclonal Antibody
HC130014-02 100 µg

Anti-Human B3GNT6 Polyclonal Antibody

Sign In for Pricing
View Details