Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT3 Rabbit Polyclonal Antibody (HRP)

IFIT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG-49, GARG-49

UniProt

O14879

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLL

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001540.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC105 CRISPR/Cas9 KO Plasmid (m)
sc-427852 20 µg

CCDC105 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CP Antibody, Biotin conjugated
A45732-100UG 100 µg

CP Antibody, Biotin conjugated

Sign In for Pricing
View Details
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8) (MaxLight 405) discontinued
037366-ML405 100 µL

KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Sirpb1a Recombinant Protein (Mouse)
RP171956 100 µg

Sirpb1a Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-Ocular development associated gene (GATAD1) Mouse Monoclonal Antibody [Clone ID: OTI1H1]
M10741 100 µL

Anti-Ocular development associated gene (GATAD1) Mouse Monoclonal Antibody [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Anti-NDUFB9 Mouse Monoclonal Antibody [Clone ID: OTI4F8]
M08623-2 100 µL

Anti-NDUFB9 Mouse Monoclonal Antibody [Clone ID: OTI4F8]

Sign In for Pricing
View Details