Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA5 Rabbit Polyclonal Antibody (HRP)

IFNA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INA5, INFA5, leIF G, IFN-alphaG, IFN-alpha-5

UniProt

P01569

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IFNA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKD

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002160.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vortex Mixer BVMX-404
BVMX-404 1 Unit

Vortex Mixer BVMX-404

Sign In for Pricing
View Details
PSME1 Mouse Monoclonal Antibody [Clone ID: AT12H3]
AM50620PU-N 100 µL

PSME1 Mouse Monoclonal Antibody [Clone ID: AT12H3]

Sign In for Pricing
View Details
EXOC3L4 (NM_001077594) Human Over-expression Lysate
LC421461 20 µg

EXOC3L4 (NM_001077594) Human Over-expression Lysate

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F12]
TA804936AM 100 µL

PCNA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11F12]

Sign In for Pricing
View Details
Recombinant STUB1 Monoclonal Antibody
AN300116P 100 µL

Recombinant STUB1 Monoclonal Antibody

Sign In for Pricing
View Details
TOMM20 (NM_014765) Human Over-expression Lysate
LY402378 100 µg

TOMM20 (NM_014765) Human Over-expression Lysate

Sign In for Pricing
View Details