Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA5 Rabbit Polyclonal Antibody (HRP)

IFNA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INA5, INFA5, leIF G, IFN-alphaG, IFN-alpha-5

UniProt

P01569

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IFNA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKD

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002160.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGREF1 (NM_006569) Human Recombinant Protein
TP306520L 1 mg

CGREF1 (NM_006569) Human Recombinant Protein

Sign In for Pricing
View Details
IGBP1 (NM_001551) Human Over-expression Lysate
LC400594 20 µg

IGBP1 (NM_001551) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclic Ethylene Acetal Fusidic Acid
TRC-C989155-25MG 25 mg

Cyclic Ethylene Acetal Fusidic Acid

Sign In for Pricing
View Details
MAN2A2 Human Gene Knockout Kit (CRISPR)
KN420394 1 Kit

MAN2A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAK4 Rabbit Polyclonal Antibody
AP01447PU-N 100 µg

PAK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR74 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F2]
TA800440AM 100 µL

WDR74 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F2]

Sign In for Pricing
View Details