Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DS4 Rabbit Polyclonal Antibody (FITC)

KIR2DS4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KKA3, KIR1D, NKAT8, CD158I, KIR412, NKAT-8, KIR-2DS4

UniProt

P43632

Immunogen

The immunogen for Anti-KIR2DS4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2S4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSV

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_036446.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 (PTPRC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]
TA506534BM 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F6]

Sign In for Pricing
View Details
GOSR1 Antibody
8C15941-AAT 50 µg

GOSR1 Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]
E-AB-F1038M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]
E-AB-F1038M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]
E-AB-F1038M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD44 Antibody[P2A1]

Sign In for Pricing
View Details
Human C16orf54 activation kit by CRISPRa
GA117068 1 Kit

Human C16orf54 activation kit by CRISPRa

Sign In for Pricing
View Details