Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

KIR2DL4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS

UniProt

Q99706

Immunogen

The immunogen for Anti-KIR2DL4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2L4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRA

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3-Bromopropyl) -3-methoxybenzene
GAA94397-01 100 mg

1- (3-Bromopropyl) -3-methoxybenzene

Sign In for Pricing
View Details
1- (3-Bromopropyl) -3-methoxybenzene
GAA94397-02 1 g

1- (3-Bromopropyl) -3-methoxybenzene

Sign In for Pricing
View Details
Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody
abx135837-01 60 µL

Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody

Sign In for Pricing
View Details
Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody
abx135837-02 120 µL

Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody

Sign In for Pricing
View Details
Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody
abx135837-03 200 µL

Membrane-Associated Guanylate Kinase, WW And PDZ Domain-Containing Protein 3 (MAGI3) Antibody

Sign In for Pricing
View Details
MYO18A Knockout HEK293T Polyclonal Cells
ARG3389 1 Million

MYO18A Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details