Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL4 Rabbit Polyclonal Antibody (HRP)

KIR2DL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G9P, CD158D, KIR103, KIR-2DL4, KIR103AS, KIR-103AS

UniProt

Q99706

Immunogen

The immunogen for Anti-KIR2DL4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2L4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRA

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine ERK2 ELISA Kit
EPE0066 96 Tests

Porcine ERK2 ELISA Kit

Sign In for Pricing
View Details
Rab22a ORF Vector (Mouse) (pORF)
ORF055409 1.0 µg DNA

Rab22a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
IL-3RB/Csf2rb/IL Rabbit Polyclonal Antibody (Fluoro647)
orb3111329 100 µg

IL-3RB/Csf2rb/IL Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Rsk2 Polyclonal Antibody, Cy5.5 Conjugated
bs-3554R-Cy5.5 100 µL

Rsk2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
PLCG1, Phosphorylated (Y771) (Phospholipase C-gamma-1, PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1) (MaxLight 750)
MBS6431895-01 0.1 mL

PLCG1, Phosphorylated (Y771) (Phospholipase C-gamma-1, PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1) (MaxLight 750)

Sign In for Pricing
View Details
PLCG1, Phosphorylated (Y771) (Phospholipase C-gamma-1, PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1) (MaxLight 750)
MBS6431895-02 5x 0.1 mL

PLCG1, Phosphorylated (Y771) (Phospholipase C-gamma-1, PLC1, NCKAP3, PLC-II, PLC148, PLCgamma1) (MaxLight 750)

Sign In for Pricing
View Details