Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL2 Rabbit Polyclonal Antibody (FITC)

KIR3DL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL2

UniProt

P43630

Immunogen

The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006728.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 488-Wheat Germ Agglutinin (WGA) Conjugate
25530-AAT 1 mg

IFluor® 488-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
DHLAG (CD74) (NM_001025158) Human Over-expression Lysate
LC422594 20 µg

DHLAG (CD74) (NM_001025158) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL
BNC941154-100 1x 100 µL

Mucin 3 (MUC3/1154), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PELATON activation kit by CRISPRa
GA119293 1 Kit

Human PELATON activation kit by CRISPRa

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF640R conjugate, 0.1mg/mL
BNC402755-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emp3 (NM_010129) Mouse Tagged ORF Clone
MG201299 10 µg

Emp3 (NM_010129) Mouse Tagged ORF Clone

Sign In for Pricing
View Details