Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL2 Rabbit Polyclonal Antibody (HRP)

KIR3DL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL2

UniProt

P43630

Immunogen

The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006728.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (13C4), 0.2mg/mL
BNUB0147-100 1x 100 µL

Pgp9.5 (UCHL-1) (13C4), 0.2mg/mL

Sign In for Pricing
View Details
Human BNP Antibody Pair Set
E-KAB-0180 50 µL & 100 µg

Human BNP Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Human CDKN1B Protein (His Tag)
PKSH032314-01 10 µg

Recombinant Human CDKN1B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CDKN1B Protein (His Tag)
PKSH032314-02 50 µg

Recombinant Human CDKN1B Protein (His Tag)

Sign In for Pricing
View Details
Ninein (NIN) Human Gene Knockout Kit (CRISPR)
KN415020 1 Kit

Ninein (NIN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF812122 100 µg

HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details