Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL2 Rabbit Polyclonal Antibody (HRP)

KIR3DL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

3DL2, p140, NKAT4, CD158K, NKAT-4, NKAT4B, KIR-3DL2

UniProt

P43630

Immunogen

The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTY

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006728.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH9 (NM_203487) Human Over-expression Lysate
LC404244 20 µg

PCDH9 (NM_203487) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF488A conjugate, 0.1mg/mL
BNC882593-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APPBP1 (NAE1) Human Gene Knockout Kit (CRISPR)
KN201326BN 1 Kit

APPBP1 (NAE1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cleaved Caspase-3 Recombinant Rabbit monoclonal Antibody
HA750053 100 µL

Cleaved Caspase-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
General Purpose Oven BOGP-101
BOGP-101 1 Unit

General Purpose Oven BOGP-101

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF594 conjugate, 0.1mg/mL
BNC941974-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details