Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA5 Rabbit Polyclonal Antibody (FITC)

KPNA5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SRP6, IPOA6

UniProt

O15131

Immunogen

The immunogen for Anti-KPNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESP

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 550)
126737-ML550 100 µL

FDPS (Farnesyl Pyrophosphate Synthase, FPP Synthase, FPS, Farnesyl Diphosphate Synthase, FPS, KIAA1293) (MaxLight 550)

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-01 48 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-02 96 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-03 5x 96 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details
Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit
MBS1603419-04 10x 96 Well

Canine Rho Guanine Nucleotide Exchange Factor 16 ELISA Kit

Sign In for Pricing
View Details
Pnma1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7104504 1.0 µg DNA

Pnma1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details