Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KPNA5 Rabbit Polyclonal Antibody (HRP)

KPNA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRP6, IPOA6

UniProt

O15131

Immunogen

The immunogen for Anti-KPNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human IMA6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESP

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlamydophila Trachomatis ompA Protein (aa 23-397) (serovar L3)
VAng-Lsx6916-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis ompA Protein (aa 23-397) (serovar L3)

Sign In for Pricing
View Details
TTLL9 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
48735156 3x 1.0 µg DNA

TTLL9 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (HRP)
MBS6423970-01 0.1 mL

KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (HRP)

Sign In for Pricing
View Details
KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (HRP)
MBS6423970-02 5x 0.1 mL

KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (HRP)

Sign In for Pricing
View Details
Rabbit Monoclonal HLA DQ Antibody (HLA-DQA1/2866R) [Alexa Fluor 532]
NBP3-08747AF532 100 µL

Rabbit Monoclonal HLA DQ Antibody (HLA-DQA1/2866R) [Alexa Fluor 532]

Sign In for Pricing
View Details
PCMV-GFRA1-2-3xFLAG-Neo Plasmid
PVT67236 2 µg

PCMV-GFRA1-2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details