Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT15 Rabbit Polyclonal Antibody (Biotin)

KRT15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K15, CK15, K1CO

UniProt

P19012

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse

Tested Applications

IHC, WB

NCBI Accession Number

NP_002266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 Rabbit Polyclonal Antibody (Cy3)
orb983270 100 µL

DR5 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
MBS958127-01 0.02 mg (E-Coli)

Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)

Sign In for Pricing
View Details
Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
MBS958127-02 0.02 mg (Yeast)

Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)

Sign In for Pricing
View Details
Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
MBS958127-03 0.1 mg (E-Coli)

Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)

Sign In for Pricing
View Details
Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
MBS958127-04 0.1 mg (Yeast)

Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)

Sign In for Pricing
View Details
Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
MBS958127-05 0.02 mg (Baculovirus)

Recombinant Human Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)

Sign In for Pricing
View Details