Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT15 Rabbit Polyclonal Antibody (HRP)

KRT15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K15, CK15, K1CO

UniProt

P19012

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse

Tested Applications

IHC, WB

NCBI Accession Number

NP_002266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii rplF Protein (aa 1-177) (strain CDC 3083-94 / BS512)
VAng-Lsx09337-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii rplF Protein (aa 1-177) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details
Bovine Telomerase ELISA Kit
OM619156 96 Strip Well

Bovine Telomerase ELISA Kit

Sign In for Pricing
View Details
Rras2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7303503 1.0 µg DNA

Rras2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
0.1ml PCR 8-Strip Tubes, Low Profile, Clear with Optically Clear Caps, Biorad compatible
PCR-0108LP-TCP-C 120 Strips/Pack; 10 Packs/Case

0.1ml PCR 8-Strip Tubes, Low Profile, Clear with Optically Clear Caps, Biorad compatible

Sign In for Pricing
View Details
Human TMIGD2/CD28H/IGPR1 Antibody
E55A06453 100 µg

Human TMIGD2/CD28H/IGPR1 Antibody

Sign In for Pricing
View Details
Atp5l2-ps Mouse siRNA Oligo Duplex (Locus ID 100040708)
SR401175 1 Kit

Atp5l2-ps Mouse siRNA Oligo Duplex (Locus ID 100040708)

Sign In for Pricing
View Details