Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Rabbit Polyclonal Antibody (Biotin)

TRAP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSP75, HSP 75, HSP90L, TRAP-1

UniProt

Q12931

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRAP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AQLGPRRNPAWSLQAGRLFSTQTAEDKEEPLHSIISSTESVQGSTSKHEF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057376

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Petroselinic acid
C09326-25mg 25 mg

Petroselinic acid

Sign In for Pricing
View Details
Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial
MBS1208085-01 0.05 mg (E-Coli)

Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial

Sign In for Pricing
View Details
Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial
MBS1208085-02 0.05 mg (Yeast)

Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial

Sign In for Pricing
View Details
Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial
MBS1208085-03 0.2 mg (E-Coli)

Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial

Sign In for Pricing
View Details
Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial
MBS1208085-04 0.05 mg (Baculovirus)

Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial

Sign In for Pricing
View Details
Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial
MBS1208085-05 0.5 mg (E-Coli)

Recombinant Human Putative tyrosine-protein phosphatase auxilin (DNAJC6) , partial

Sign In for Pricing
View Details