Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINA1 Rabbit Polyclonal Antibody (FITC)

SERPINA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT

UniProt

P01009

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_000286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal G protein alpha 16 Antibody (OTI6B3) [Allophycocyanin]
NBP2-70836APC 0.1 mL

Mouse Monoclonal G protein alpha 16 Antibody (OTI6B3) [Allophycocyanin]

Sign In for Pricing
View Details
Adamtsl2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3545804 1.0 µg DNA

Adamtsl2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RPL15P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1911208 1.0 µg DNA

RPL15P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (PE)
MBS6184204-01 0.1 mL

TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (PE)

Sign In for Pricing
View Details
TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (PE)
MBS6184204-02 5x 0.1 mL

TIMP1 (TIMP Metallopeptidase Inhibitor 1, CLGI, EPA, EPO, FLJ90373, HCI, TIMP) (PE)

Sign In for Pricing
View Details
Thermometer, Red Spirit Filled, White Backed
2013800/1B 1 Each

Thermometer, Red Spirit Filled, White Backed

Sign In for Pricing
View Details