Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP3 Rabbit Polyclonal Antibody (HRP)

CASP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CPP32, SCA-1, CPP32B

UniProt

P42574

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCXD3 Recombinant Protein (Human)
RP083838 100 µg

PLCXD3 Recombinant Protein (Human)

Sign In for Pricing
View Details
C1QTNF9 Polyclonal Antibody, Cy3 Conjugated
bs-15085R-Cy3 100 µL

C1QTNF9 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (AP)
MBS6134728-01 0.1 mL

ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (AP)

Sign In for Pricing
View Details
ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (AP)
MBS6134728-02 5x 0.1 mL

ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (AP)

Sign In for Pricing
View Details
JIP-3 Polyclonal Antibody
E20-72436 100 µg

JIP-3 Polyclonal Antibody

Sign In for Pricing
View Details
MOCA Lentiviral Activation Particles (m2)
sc-431593-LAC-2 200 µL

MOCA Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details