Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSE1L Rabbit Polyclonal Antibody (Biotin)

CSE1L Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAS, CSE1, XPO2

UniProt

P55060

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CSE1L

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001307

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423254-01 0.12 mL

Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423254-02 0.2 mL

Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)
MBS8423254-03 5x 0.2 mL

Rabbit Anti CDKN1B Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC)

Sign In for Pricing
View Details
Annexin A5, Recombinant, Human, aa1-320 (Annexin V)
349678-01 20 µg

Annexin A5, Recombinant, Human, aa1-320 (Annexin V)

Sign In for Pricing
View Details
Annexin A5, Recombinant, Human, aa1-320 (Annexin V)
349678-02 100 µg

Annexin A5, Recombinant, Human, aa1-320 (Annexin V)

Sign In for Pricing
View Details
Annexin A5, Recombinant, Human, aa1-320 (Annexin V)
349678-03 500 µg

Annexin A5, Recombinant, Human, aa1-320 (Annexin V)

Sign In for Pricing
View Details