Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIPK3 Rabbit Polyclonal Antibody (FITC)

RIPK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RIP3

UniProt

Q9Y572

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RIPK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLST (dihydrolipoamide S-succinyltransferase (E2 Component of 2-oxo-glutarate Complex), DLTS) (HRP)
MBS6183459-01 0.1 mL

DLST (dihydrolipoamide S-succinyltransferase (E2 Component of 2-oxo-glutarate Complex), DLTS) (HRP)

Sign In for Pricing
View Details
DLST (dihydrolipoamide S-succinyltransferase (E2 Component of 2-oxo-glutarate Complex), DLTS) (HRP)
MBS6183459-02 5x 0.1 mL

DLST (dihydrolipoamide S-succinyltransferase (E2 Component of 2-oxo-glutarate Complex), DLTS) (HRP)

Sign In for Pricing
View Details
NSMCE2 Antibody
orb1337370 100 µg

NSMCE2 Antibody

Sign In for Pricing
View Details
HMGCR Human shRNA Lentiviral Particle (Locus ID 3156)
TL312393V 500 µL Each

HMGCR Human shRNA Lentiviral Particle (Locus ID 3156)

Sign In for Pricing
View Details
CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) (MaxLight 550) discontinued
C7978-25C-ML550 100 µL

CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ORF73/HHV8 Antibody (HHV8/3606) [Janelia Fluor 646]
NBP3-08645JF646 100 µL

Mouse Monoclonal ORF73/HHV8 Antibody (HHV8/3606) [Janelia Fluor 646]

Sign In for Pricing
View Details