What is the catalog number for TNFRSF1A Rabbit Polyclonal Antibody (HRP)?

The catalog number for TNFRSF1A Rabbit Polyclonal Antibody (HRP) is orb2081519.

What sizes are available for TNFRSF1A Rabbit Polyclonal Antibody (HRP)?

TNFRSF1A Rabbit Polyclonal Antibody (HRP) is available in the following size(s): 100 µL.

Is TNFRSF1A Rabbit Polyclonal Antibody (HRP) in stock?

TNFRSF1A Rabbit Polyclonal Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

TNFRSF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FPF, p55, p60, TBP1, TNF-R, TNFAR, TNFR1, p55-R, CD120a, TNFR55, TNFR60, TNF-R-I, TNF-R55

UniProt

P19438

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.