Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF1A Rabbit Polyclonal Antibody (HRP)

TNFRSF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FPF, p55, p60, TBP1, TNF-R, TNFAR, TNFR1, p55-R, CD120a, TNFR55, TNFR60, TNF-R-I, TNF-R55

UniProt

P19438

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse

Tested Applications

IF, WB

NCBI Accession Number

NP_001056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KOELGAS450X52RL-T1-LL-P2 Pipe Markers for Gases
N004348 30 Pack (30 Marker (s) x 1 Roll)

KOELGAS450X52RL-T1-LL-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
Mmu-miR-6900-3p mimic
HY-R03520-01 5 nmol

Mmu-miR-6900-3p mimic

Sign In for Pricing
View Details
Mmu-miR-6900-3p mimic
HY-R03520-02 20 nmol

Mmu-miR-6900-3p mimic

Sign In for Pricing
View Details
Anti-Human CD166 Recombinant Antibody
YR1594-01 1 mg

Anti-Human CD166 Recombinant Antibody

Sign In for Pricing
View Details
Anti-Human CD166 Recombinant Antibody
YR1594-02 5 mg

Anti-Human CD166 Recombinant Antibody

Sign In for Pricing
View Details
Human Monoclonal Histone H1 Antibody (derlotuximab) [Janelia Fluor 585]
NBP3-27977JF585 0.1 mL

Human Monoclonal Histone H1 Antibody (derlotuximab) [Janelia Fluor 585]

Sign In for Pricing
View Details