Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3F3A (Phospho-Histone H3) Rabbit Polyclonal Antibody (HRP)

H3F3A (Phospho-Histone H3) Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H3t, H3.4, H3/g, H3FT, HIST3H3

UniProt

P84243

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HIST3H3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALR

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003484

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coiled Coil Domain Containing Protein 80 (Biotin)
546066 200 µL

Coiled Coil Domain Containing Protein 80 (Biotin)

Sign In for Pricing
View Details
Ssbp1 3'UTR GFP Stable Cell Line
TU169728 1.0 mL

Ssbp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Human EZR/RDX/MSN pAb
PA12067-01 50 μL

Rabbit Anti-Human EZR/RDX/MSN pAb

Sign In for Pricing
View Details
Rabbit Anti-Human EZR/RDX/MSN pAb
PA12067-02 100 μL

Rabbit Anti-Human EZR/RDX/MSN pAb

Sign In for Pricing
View Details
Endothelial lipase
E8ER1908-11 100 µL

Endothelial lipase

Sign In for Pricing
View Details
PAX5 Human shRNA Plasmid Kit (Locus ID 5079)
TL302663 1 Kit

PAX5 Human shRNA Plasmid Kit (Locus ID 5079)

Sign In for Pricing
View Details