Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC42 Rabbit Polyclonal Antibody (FITC)

CDC42 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TKS, G25K, CDC42Hs

UniProt

P60953

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_001782

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-bromophenyl) -1H-tetrazole
sc-332761A 1 g

1- (4-bromophenyl) -1H-tetrazole

Sign In for Pricing
View Details
DBF4B (NM_145663) Human Over-expression Lysate
LH14301V 100 µg

DBF4B (NM_145663) Human Over-expression Lysate

Sign In for Pricing
View Details
Clavulanic acid 10mg
A12384-10 10 mg

Clavulanic acid 10mg

Sign In for Pricing
View Details
Chromogranin A, mixed clones (BSA & Azide Free) (CGA, CHG A, Pancreastatin, Parathyroid secretory protein 1, Pituitary secretory protein I, Vasostatin, SPI) (HRP)
MBS6266744-01 0.1 mL

Chromogranin A, mixed clones (BSA & Azide Free) (CGA, CHG A, Pancreastatin, Parathyroid secretory protein 1, Pituitary secretory protein I, Vasostatin, SPI) (HRP)

Sign In for Pricing
View Details
Chromogranin A, mixed clones (BSA & Azide Free) (CGA, CHG A, Pancreastatin, Parathyroid secretory protein 1, Pituitary secretory protein I, Vasostatin, SPI) (HRP)
MBS6266744-02 5x 0.1 mL

Chromogranin A, mixed clones (BSA & Azide Free) (CGA, CHG A, Pancreastatin, Parathyroid secretory protein 1, Pituitary secretory protein I, Vasostatin, SPI) (HRP)

Sign In for Pricing
View Details
Human GBP5 Recombinant Protein
PPT-12854 100 µg

Human GBP5 Recombinant Protein

Sign In for Pricing
View Details