Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRADD Rabbit Polyclonal Antibody (FITC)

TRADD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hs.89862

UniProt

Q15628

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRADD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGL

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_003780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAAT1 Lentiviral Activation Particles (h)
sc-400917-LAC 200 µL

EAAT1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
C8orf77 CRISPR Knock Out 293T Cell Line (Human)
14754141 1x 10^6 Cells / 1.0 mL

C8orf77 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
MBS2034309-01 0.01 mg

Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)

Sign In for Pricing
View Details
Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
MBS2034309-02 0.05 mg

Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)

Sign In for Pricing
View Details
Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
MBS2034309-03 0.1 mg

Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)

Sign In for Pricing
View Details
Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)
MBS2034309-04 0.2 mg

Recombinant Nuclear Factor, Erythroid Derived 2 Like Protein 2 (NFE2L2)

Sign In for Pricing
View Details