Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAX Rabbit Polyclonal Antibody (FITC)

BAX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BCL2L4

UniProt

Q07812

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BAX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

IHC, WB

NCBI Accession Number

NP_620116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine c-myc (c-myc Oncogene Product) ValidElisa Kit
EK344386 96 Well

Porcine c-myc (c-myc Oncogene Product) ValidElisa Kit

Sign In for Pricing
View Details
Donkey anti-Mouse IgG (H&L) - Affinity Pure, min x w/bovine, chicken, goat, guinea pig, hamster, horse, human, rabbit, rat or sheep IgG
MBS687422-01 2 mg

Donkey anti-Mouse IgG (H&L) - Affinity Pure, min x w/bovine, chicken, goat, guinea pig, hamster, horse, human, rabbit, rat or sheep IgG

Sign In for Pricing
View Details
Donkey anti-Mouse IgG (H&L) - Affinity Pure, min x w/bovine, chicken, goat, guinea pig, hamster, horse, human, rabbit, rat or sheep IgG
MBS687422-02 5x 2 mg

Donkey anti-Mouse IgG (H&L) - Affinity Pure, min x w/bovine, chicken, goat, guinea pig, hamster, horse, human, rabbit, rat or sheep IgG

Sign In for Pricing
View Details
Pan-MAGUK (Postsynaptic Density Protein 95, PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90) (Biotin)
P4700-08F-Biotin 100 µL

Pan-MAGUK (Postsynaptic Density Protein 95, PSD-95, PSD95, Discs Large Homolog 4, DLG4, Post-synaptic Density Protein 95, Synapse-associated Protein 90, SAP90, SAP-90) (Biotin)

Sign In for Pricing
View Details
MYBPHL Rabbit pAb, AE conjugated
orb2841513 100 µL

MYBPHL Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
ADORA1 Antibody
orb1268316 400 μl

ADORA1 Antibody

Sign In for Pricing
View Details