Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAX Rabbit Polyclonal Antibody (HRP)

BAX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BCL2L4

UniProt

Q07812

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BAX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

IHC, WB

NCBI Accession Number

NP_620116

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700015E13Rik AAV Vector (Mouse) (CMV)
10159104 1 µg

1700015E13Rik AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
GENLISA Human Interleukin 12A (IL-12A / IL12A) ELISA
KBH12212 1x 96 Well

GENLISA Human Interleukin 12A (IL-12A / IL12A) ELISA

Sign In for Pricing
View Details
NUP50 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62925R-BF750-TR 20 µL

NUP50 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
MINI PIC1802-10X10-GHS02/96 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
814015 96 Sheet (96 Panel (s) x 1 Sheet)

MINI PIC1802-10X10-GHS02/96 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Lentiviral mouse Pglyrp4 shRNA (UAS) - Lentiviral mouse Pglyrp4 shRNA (UAS, iRFP) (25)
GTR15197510 1 Vial

Lentiviral mouse Pglyrp4 shRNA (UAS) - Lentiviral mouse Pglyrp4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human MAB21L3 sgRNA gene knockout kit - Lentiviral human MAB21L3 sgRNA gene knockout kit (25)
GTR15395622 1 Vial

Lentiviral human MAB21L3 sgRNA gene knockout kit - Lentiviral human MAB21L3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details