Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17A Rabbit Polyclonal Antibody (HRP)

STK17A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRAK1

UniProt

Q9UEE5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STK17A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig

Tested Applications

WB

NCBI Accession Number

NP_004751

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 0/MIP Rabbit Polyclonal Antibody (APC)
orb2575294 100 µg

Aquaporin 0/MIP Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
(E)-2-hydroxy-6-(4-hydroxystyryl)benzoic acid
TRC-H090880-50MG 50 mg

(E)-2-hydroxy-6-(4-hydroxystyryl)benzoic acid

Sign In for Pricing
View Details
LOC689963 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6476203 1.0 µg DNA

LOC689963 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
VOC Std Ethanol 1000ug/mL in MeOH - 1ML
REVOC360 1 mL

VOC Std Ethanol 1000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
SOBP shRNA Plasmid (h)
sc-95171-SH 20 µg

SOBP shRNA Plasmid (h)

Sign In for Pricing
View Details
Mouse Homeobox protein Hox-B4, HOXB4 ELISA Kit
MBS9318829-01 48 Well

Mouse Homeobox protein Hox-B4, HOXB4 ELISA Kit

Sign In for Pricing
View Details