Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR3 Rabbit Polyclonal Antibody (Biotin)

WDR3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DIP2, UTP12

UniProt

Q9UNX4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WDR3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHEX Protein Vector (Human) (pPM-C-His)
PV019516 500 ng

HHEX Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Prmt7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37721114 3x 1.0 µg

Prmt7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ADAP1 antibody
70R-15586 50 μL

ADAP1 antibody

Sign In for Pricing
View Details
CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (Biotin)
MBS6248617-01 0.1 mL

CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (Biotin)

Sign In for Pricing
View Details
CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (Biotin)
MBS6248617-02 5x 0.1 mL

CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (Biotin)

Sign In for Pricing
View Details
Chitinase 3 like protein 2 Rabbit Polyclonal Antibody (APC)
orb996889 100 µL

Chitinase 3 like protein 2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details