Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53 Rabbit Polyclonal Antibody (FITC)

TP53 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P53, BCC7, LFS1, BMFS5, TRP53

UniProt

P04637

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TP53

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000537

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)
MBS2102822-01 5x 96 Tests

Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)
MBS2102822-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)
MBS2102822-03 10x 96 Tests

Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)
MBS2102822-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Alanine Aminotransferase 2 (ALT2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit anti-human Calcium Channels A, B or C IgG fraction (polyclonal)
PC-903A-9 1 mg

Rabbit anti-human Calcium Channels A, B or C IgG fraction (polyclonal)

Sign In for Pricing
View Details
USP2 Rabbit Polyclonal Antibody
orb632434-01 50 µg

USP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details