Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAE Rabbit Polyclonal Antibody (HRP)

YWHAE Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDS, HEL2, MDCR, KCIP-1, 14-3-3E

UniProt

P62258

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human YWHAE

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLN6 Rabbit pAb
MBS9143357-01 0.02 mL

CLN6 Rabbit pAb

Sign In for Pricing
View Details
CLN6 Rabbit pAb
MBS9143357-02 0.1 mL

CLN6 Rabbit pAb

Sign In for Pricing
View Details
CLN6 Rabbit pAb
MBS9143357-03 5x 0.1 mL

CLN6 Rabbit pAb

Sign In for Pricing
View Details
Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit
MBS9342089-01 48 Well

Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit

Sign In for Pricing
View Details
Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit
MBS9342089-02 96 Well

Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit

Sign In for Pricing
View Details
Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit
MBS9342089-03 5x 96 Well

Mouse Protein disulfide-isomerase-like protein of the testis, PDILT ELISA Kit

Sign In for Pricing
View Details