Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK6 Rabbit Polyclonal Antibody (HRP)

CDK6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCPH12, PLSTIRE

UniProt

Q00534

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001250

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7) [FITC]
NBP2-73659F 0.1 mL

Mouse Monoclonal Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7) [FITC]

Sign In for Pricing
View Details
RGD1304624 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38909156 3x 1.0 µg DNA

RGD1304624 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human CAPZB ELISA Kit (Colorimetric)
NBP3-27291 1 Kit

Human CAPZB ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Human Protein Kinase C Delta ELISA Kit (PKCd)
RK02091 96 Tests

Human Protein Kinase C Delta ELISA Kit (PKCd)

Sign In for Pricing
View Details
Recombinant Human RANBP3 Protein, His, E.coli-20ug
QP13262-20ug 20ug

Recombinant Human RANBP3 Protein, His, E.coli-20ug

Sign In for Pricing
View Details
Recombinant Xenopus laevis Histone deacetylase complex subunit SAP30L-B (sap30l-b)
MBS1381233-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Histone deacetylase complex subunit SAP30L-B (sap30l-b)

Sign In for Pricing
View Details