Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK3 Rabbit Polyclonal Antibody (FITC)

CDK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q00526

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Azurocidin 1 ELISA kit
GTR10416391 96 Well

Rabbit Azurocidin 1 ELISA kit

Sign In for Pricing
View Details
PMS1 CRISPRa sgRNA lentivector (set of three targets)(Human)
37074121 3x 1.0µg DNA

PMS1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TMEM27, Recombinant, Human, Fc-Tag discontinued
046413 100 µg

TMEM27, Recombinant, Human, Fc-Tag discontinued

Sign In for Pricing
View Details
Anti-ABCA4 Antibody Picoband®, Dylight550 Conjugate
PA2065-Dylight550 100 µg

Anti-ABCA4 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
MTMR2 Rabbit Polyclonal Antibody (FITC)
orb2599012 100 µg

MTMR2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
EMR4 Rabbit pAb
E47R14589 100 µL

EMR4 Rabbit pAb

Sign In for Pricing
View Details