Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK3 Rabbit Polyclonal Antibody (FITC)

CDK3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q00526

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CDK3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI3B4]
CF800093 100 µg

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI3B4]

Sign In for Pricing
View Details
MFluor™ Red 700 Anti-human CD23 Antibody *EBVCS-5*
102300V1-AAT 500 Tests

MFluor™ Red 700 Anti-human CD23 Antibody *EBVCS-5*

Sign In for Pricing
View Details
Neuronal thread protein AD7c-NTP Rabbit Polyclonal Antibody (Cy5)
orb915835 100 µL

Neuronal thread protein AD7c-NTP Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
BRI3 Protein Lysate (Rat) with C-HA Tag
13475036 100 µg

BRI3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human PLD1 Protein, N-His
bs-101924P-01 20 µg

Recombinant Human PLD1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PLD1 Protein, N-His
bs-101924P-02 50 µg

Recombinant Human PLD1 Protein, N-His

Sign In for Pricing
View Details