Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNT1 Rabbit Polyclonal Antibody (HRP)

CCNT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCNT, CYCT1, HIVE1

UniProt

O60563

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCNT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Tuberculosis dapF Protein (aa 1-289)
VAng-Yyj0036-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis dapF Protein (aa 1-289)

Sign In for Pricing
View Details
Keratin Type I Cytoskeletal 18 (KRT18) Rabbit anti-Human Polyclonal Antibody
GWB-37C321 0.05 mg

Keratin Type I Cytoskeletal 18 (KRT18) Rabbit anti-Human Polyclonal Antibody

Sign In for Pricing
View Details
KNPEP sgRNA CRISPR Lentivector (Human) (Target 2)
K1163003 1.0 µg DNA

KNPEP sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Human Metallothionein-1G Protein, GST, E.coli-1mg
QP8897-ec-1mg 1mg

Recombinant Human Metallothionein-1G Protein, GST, E.coli-1mg

Sign In for Pricing
View Details
RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033)
132569 50 µg

RHOXF1 (OTEX, PEPP1, Rhox Homeobox Family Member 1, Ovary-, Testis- and Epididymis-expressed Gene Protein, Paired-like Homeobox Protein PEPP-1, MGC119030, MGC119033)

Sign In for Pricing
View Details
Cathepsin C (CTSC, Cathepsin J, CPPI, Dipeptidyl Peptidase 1, DPP1, Dipeptidyl Peptidase I, DPPI, DPP-I, Dipeptidyl Transferase, HMS, JP, JPD, PALS, PLS)
139654 200 µL

Cathepsin C (CTSC, Cathepsin J, CPPI, Dipeptidyl Peptidase 1, DPP1, Dipeptidyl Peptidase I, DPPI, DPP-I, Dipeptidyl Transferase, HMS, JP, JPD, PALS, PLS)

Sign In for Pricing
View Details