Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNH Rabbit Polyclonal Antibody (Biotin)

CCNH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CAK, p34, p37, CycH

UniProt

P51946

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CCNH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A2 (NM_001278658) Human Tagged ORF Clone
RC238018 10 µg

SLC2A2 (NM_001278658) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ianalumab (Anti-TNFRSF13C / BAFFR / CD268)
A2329-1mg*25 25x 1 mg

Ianalumab (Anti-TNFRSF13C / BAFFR / CD268)

Sign In for Pricing
View Details
GOLGA7 CRISPR Activation Plasmid (h2)
sc-409924-ACT-2 20 µg

GOLGA7 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (PE)
135077-PE 100 µL

UGT2B15 (UDP-glucuronosyltransferase 2B15, UDPGT 2B15, UDPGT2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGT 2B8, UGT2B8, UDPGTH3, UDPGTh-3) (PE)

Sign In for Pricing
View Details
Recombinant Human ECD Protein, N-His
HF615012-01 50 µg

Recombinant Human ECD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ECD Protein, N-His
HF615012-02 100 µg

Recombinant Human ECD Protein, N-His

Sign In for Pricing
View Details