Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC20 Rabbit Polyclonal Antibody (HRP)

CDC20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDC20A, p55CDC, bA276H19.3

UniProt

Q12834

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDC20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001246

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB5D2 CRISPR/Cas9 KO Plasmid (m)
sc-431437 20 µg

CYB5D2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Cyclohexyl valerate
sc-268804 25 g

Cyclohexyl valerate

Sign In for Pricing
View Details
Kif12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6051905 3x 1.0 µg

Kif12 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
UBL4A Antibody - C-terminal region : Biotin (ARP59393_P050-Biotin)
ARP59393_P050-Biotin 100 µL

UBL4A Antibody - C-terminal region : Biotin (ARP59393_P050-Biotin)

Sign In for Pricing
View Details
Lentiviral human FAM184A sgRNA gene knockout kit - Lentiviral human FAM184A sgRNA gene knockout kit (100)
GTR15393616 1 Vial

Lentiviral human FAM184A sgRNA gene knockout kit - Lentiviral human FAM184A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse Cyp11b2 activation kit by CRISPRa
GA200968 1 Kit

Mouse Cyp11b2 activation kit by CRISPRa

Sign In for Pricing
View Details